Lineage for d5in8d_ (5in8 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731747Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 2731778Protein automated matches [190618] (1 species)
    not a true protein
  7. 2731779Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2731835Domain d5in8d_: 5in8 D: [317766]
    Other proteins in same PDB: d5in8b2
    automated match to d2oa6d_
    complexed with gol, mg, po4, pop

Details for d5in8d_

PDB Entry: 5in8 (more details), 2.35 Å

PDB Description: crystal structure of q151h aspergillus terreus aristolochene synthase
PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d5in8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5in8d_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmrahtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

SCOPe Domain Coordinates for d5in8d_:

Click to download the PDB-style file with coordinates for d5in8d_.
(The format of our PDB-style files is described here.)

Timeline for d5in8d_: