Lineage for d5ikia_ (5iki A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (72 species)
    not a true protein
  7. 2331686Species Bacillus megaterium [TaxId:1404] [312142] (2 PDB entries)
  8. 2331689Domain d5ikia_: 5iki A: [317762]
    automated match to d4yt3b_
    complexed with a9h, hem

Details for d5ikia_

PDB Entry: 5iki (more details), 2.4 Å

PDB Description: cyp106a2 with substrate abietic acid
PDB Compounds: (A:) Cytochrome P450(MEG)

SCOPe Domain Sequences for d5ikia_:

Sequence, based on SEQRES records: (download)

>d5ikia_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
viavkeitrfktrteefspyawckrmlendpvsyhegtdtwnvfkyedvkrvlsdykhfs
svrkrttisvgtdseegsvpekiqitesdppdhrkrrsllaaaftprslqnwepriqeia
deligqmdggteidivaslasplpiivmadlmgvpskdrllfkkwvdtlflpfdrekqee
vdklkqvaakeyyqylypivvqkrlnpaddiisdllksevdgemftddevvrttmlilga
gvettshllansfysllyddkevyqelhenldlvpqaveemlrfrfnlikldrtvkednd
llgvelkegdsvvvwmsaanmdeemfedpftlnihrpnnkkhltfgngphfclgaplarl
eakialtaflkkfkhieavpsfqleenltdsatgqtltslplkasr

Sequence, based on observed residues (ATOM records): (download)

>d5ikia_ a.104.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
viavkeitrfktrteefspyawckrmlendpvsyhegtdtwnvfkyedvkrvlsdykhfs
svrksvpekiqitesdppdhrkrrsllaaaftprslqnwepriqeiadeligqmdggtei
divaslasplpiivmadlmgvpskdrllfkkwvdtlflpklkqvaakeyyqylypivvqk
rlnpaddiisdllksevdgemftddevvrttmlilgagvettshllansfysllyddkev
yqelhenldlvpqaveemlrfrfnlikldrtvkedndllgvelkegdsvvvwmsaanmde
emfedpftlnihrpnnkkhltfgngphfclgaplarleakialtaflkkfkhieavpsfq
leenltdsatgqtltslplkasr

SCOPe Domain Coordinates for d5ikia_:

Click to download the PDB-style file with coordinates for d5ikia_.
(The format of our PDB-style files is described here.)

Timeline for d5ikia_: