Lineage for d5fk9a2 (5fk9 A:114-203)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030547Domain d5fk9a2: 5fk9 A:114-203 [317761]
    Other proteins in same PDB: d5fk9a1, d5fk9b1, d5fk9b2, d5fk9c1, d5fk9c2
    automated match to d4eura2
    mutant

Details for d5fk9a2

PDB Entry: 5fk9 (more details), 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5fk9a2:

Sequence, based on SEQRES records: (download)

>d5fk9a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records): (download)

>d5fk9a2 b.1.1.2 (A:114-203) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrdfksnsav
awsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d5fk9a2:

Click to download the PDB-style file with coordinates for d5fk9a2.
(The format of our PDB-style files is described here.)

Timeline for d5fk9a2: