Lineage for d5fk9a1 (5fk9 A:1-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369591Domain d5fk9a1: 5fk9 A:1-113 [317760]
    Other proteins in same PDB: d5fk9a2, d5fk9c1, d5fk9c2
    automated match to d4eura1
    mutant

Details for d5fk9a1

PDB Entry: 5fk9 (more details), 3.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5fk9a1:

Sequence, based on SEQRES records: (download)

>d5fk9a1 b.1.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgiqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrl
sattvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlan

Sequence, based on observed residues (ATOM records): (download)

>d5fk9a1 b.1.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgiqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrl
sattvaterysllyisssqttdsgvyfcavdsgtykyifgtgtrlkvlan

SCOPe Domain Coordinates for d5fk9a1:

Click to download the PDB-style file with coordinates for d5fk9a1.
(The format of our PDB-style files is described here.)

Timeline for d5fk9a1: