Lineage for d1pydb3 (1pyd B:361-556)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22856Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 22861Protein Pyruvate decarboxylase [52520] (3 species)
  7. 22871Species Brewer's yeast (Saccharomyces), uvarum strain [TaxId:230603] [52521] (1 PDB entry)
  8. 22875Domain d1pydb3: 1pyd B:361-556 [31776]
    Other proteins in same PDB: d1pyda1, d1pydb1

Details for d1pydb3

PDB Entry: 1pyd (more details), 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

SCOP Domain Sequences for d1pydb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pydb3 c.36.1.1 (B:361-556) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
pvfdapqnlvkqaklt

SCOP Domain Coordinates for d1pydb3:

Click to download the PDB-style file with coordinates for d1pydb3.
(The format of our PDB-style files is described here.)

Timeline for d1pydb3: