Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
Protein Pyruvate decarboxylase [88725] (3 species) |
Species Brewer's yeast (Saccharomyces uvarum) [TaxId:230603] [88726] (1 PDB entry) |
Domain d1pydb2: 1pyd B:2-181 [31775] Other proteins in same PDB: d1pyda1, d1pyda3, d1pydb1, d1pydb3 complexed with mg, tdp |
PDB Entry: 1pyd (more details), 2.4 Å
SCOPe Domain Sequences for d1pydb2:
Sequence, based on SEQRES records: (download)
>d1pydb2 c.36.1.5 (B:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]} seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
>d1pydb2 c.36.1.5 (B:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]} seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
Timeline for d1pydb2: