Lineage for d5g1ka2 (5g1k A:62-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877401Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
    elaborated common fold
  6. 2877427Protein automated matches [228323] (3 species)
    not a true protein
  7. 2877428Species Escherichia coli [TaxId:562] [317731] (2 PDB entries)
  8. 2877431Domain d5g1ka2: 5g1k A:62-230 [317745]
    Other proteins in same PDB: d5g1ka1, d5g1kb1
    automated match to d1v58a1
    complexed with so4; mutant

Details for d5g1ka2

PDB Entry: 5g1k (more details), 1.96 Å

PDB Description: a triple mutant of dsbg engineered for denitrosylation
PDB Compounds: (A:) thiol disulfide interchange protein dsbg

SCOPe Domain Sequences for d5g1ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g1ka2 c.47.1.9 (A:62-230) automated matches {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcgpckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvmpaiyymskentlqqavglpdqktlniimgn

SCOPe Domain Coordinates for d5g1ka2:

Click to download the PDB-style file with coordinates for d5g1ka2.
(The format of our PDB-style files is described here.)

Timeline for d5g1ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g1ka1