| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
| Protein automated matches [228323] (3 species) not a true protein |
| Species Escherichia coli [TaxId:562] [317731] (2 PDB entries) |
| Domain d5g1ka2: 5g1k A:62-230 [317745] Other proteins in same PDB: d5g1ka1, d5g1kb1 automated match to d1v58a1 complexed with so4; mutant |
PDB Entry: 5g1k (more details), 1.96 Å
SCOPe Domain Sequences for d5g1ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g1ka2 c.47.1.9 (A:62-230) automated matches {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcgpckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvmpaiyymskentlqqavglpdqktlniimgn
Timeline for d5g1ka2: