Lineage for d5fkab2 (5fka B:115-242)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757759Domain d5fkab2: 5fka B:115-242 [317743]
    Other proteins in same PDB: d5fkaa2, d5fkac1, d5fkac2
    automated match to d3q5ya2
    complexed with zn

Details for d5fkab2

PDB Entry: 5fka (more details), 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (B:) T cell receptor beta chain

SCOPe Domain Sequences for d5fkab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fkab2 b.1.1.0 (B:115-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d5fkab2:

Click to download the PDB-style file with coordinates for d5fkab2.
(The format of our PDB-style files is described here.)

Timeline for d5fkab2: