SCOPe 2.08: Domain d5fkab2: 5fka B:115-242

Lineage for d5fkab2 (5fka B:115-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5fkab2: 5fka B:115-242 [317743]
   Other proteins in same PDB: d5fkaa2, d5fkac1, d5fkac2
   automated match to d3q5ya2
   complexed with zn

Details for d5fkab2

PDB Entry: 5fka, 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor

PDB Compounds: (B:) T cell receptor beta chain

SCOPe Domain Sequences for d5fkab2:

Sequence; same for both SEQRES and ATOM records:

>d5fkab2 b.1.1.0 (B:115-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d5fkab2:

• d5fkab2 first appeared in SCOPe 2.06
  
• d5fkab2 appears in SCOPe 2.07