Lineage for d5c90l_ (5c90 L:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2435652Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2435832Protein automated matches [190149] (10 species)
    not a true protein
  7. 2436027Species Staphylococcus aureus [TaxId:93061] [189958] (6 PDB entries)
  8. 2436053Domain d5c90l_: 5c90 L: [317736]
    automated match to d3qwda_
    complexed with mpd; mutant

Details for d5c90l_

PDB Entry: 5c90 (more details), 1.75 Å

PDB Description: staphylococcus aureus clpp mutant - y63a
PDB Compounds: (L:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d5c90l_:

Sequence, based on SEQRES records: (download)

>d5c90l_ c.14.1.1 (L:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl
ainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi
hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake
yglidevmvpe

Sequence, based on observed residues (ATOM records): (download)

>d5c90l_ c.14.1.1 (L:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptvaydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsv
tagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqg
qateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmv
pe

SCOPe Domain Coordinates for d5c90l_:

Click to download the PDB-style file with coordinates for d5c90l_.
(The format of our PDB-style files is described here.)

Timeline for d5c90l_: