Lineage for d5g1la1 (5g1l A:3-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936239Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) (S)
  5. 2936272Family d.17.3.0: automated matches [228319] (1 protein)
    not a true family
  6. 2936273Protein automated matches [228320] (3 species)
    not a true protein
  7. 2936274Species Escherichia coli [TaxId:562] [317729] (2 PDB entries)
  8. 2936275Domain d5g1la1: 5g1l A:3-61 [317733]
    Other proteins in same PDB: d5g1la2, d5g1lb2
    automated match to d1v58a2
    complexed with so4; mutant

Details for d5g1la1

PDB Entry: 5g1l (more details), 1.7 Å

PDB Description: a double mutant of dsbg engineered for denitrosylation
PDB Compounds: (A:) thiol disulfide interchange protein dsbg

SCOPe Domain Sequences for d5g1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g1la1 d.17.3.0 (A:3-61) automated matches {Escherichia coli [TaxId: 562]}
lpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge

SCOPe Domain Coordinates for d5g1la1:

Click to download the PDB-style file with coordinates for d5g1la1.
(The format of our PDB-style files is described here.)

Timeline for d5g1la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g1la2