![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) ![]() |
![]() | Family d.17.3.0: automated matches [228319] (1 protein) not a true family |
![]() | Protein automated matches [228320] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [317729] (2 PDB entries) |
![]() | Domain d5g1la1: 5g1l A:3-61 [317733] Other proteins in same PDB: d5g1la2, d5g1lb2 automated match to d1v58a2 complexed with so4; mutant |
PDB Entry: 5g1l (more details), 1.7 Å
SCOPe Domain Sequences for d5g1la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g1la1 d.17.3.0 (A:3-61) automated matches {Escherichia coli [TaxId: 562]} lpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
Timeline for d5g1la1: