Lineage for d1pyda2 (1pyd A:2-181)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69360Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 69361Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 69362Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 69367Protein Pyruvate decarboxylase [52520] (3 species)
  7. 69377Species Brewer's yeast (Saccharomyces), uvarum strain [TaxId:230603] [52521] (1 PDB entry)
  8. 69378Domain d1pyda2: 1pyd A:2-181 [31773]
    Other proteins in same PDB: d1pyda1, d1pydb1

Details for d1pyda2

PDB Entry: 1pyd (more details), 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

SCOP Domain Sequences for d1pyda2:

Sequence, based on SEQRES records: (download)

>d1pyda2 c.36.1.1 (A:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

Sequence, based on observed residues (ATOM records): (download)

>d1pyda2 c.36.1.1 (A:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

SCOP Domain Coordinates for d1pyda2:

Click to download the PDB-style file with coordinates for d1pyda2.
(The format of our PDB-style files is described here.)

Timeline for d1pyda2: