SCOPe 2.08: Domain d1pyda2: 1pyd A:2-181

Lineage for d1pyda2 (1pyd A:2-181)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Pyruvate decarboxylase [88725] (3 species)

7. Species Brewer's yeast (Saccharomyces uvarum) [TaxId:230603] [88726] (1 PDB entry)

8. Domain d1pyda2: 1pyd A:2-181 [31773]
   Other proteins in same PDB: d1pyda1, d1pyda3, d1pydb1, d1pydb3
   complexed with mg, tdp

Details for d1pyda2

PDB Entry: 1pyd, 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d1pyda2:

Sequence, based on SEQRES records:

>d1pyda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd
ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

Sequence, based on observed residues (ATOM records):

>d1pyda2 c.36.1.5 (A:2-181) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces uvarum) [TaxId: 230603]}
seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy
arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsishhtlgngdftvfhrms
anisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll

Timeline for d1pyda2:

• d1pyda2 first appeared (with stable ids) in SCOP 1.55
  
• d1pyda2 appears in SCOPe 2.07