SCOPe 2.06: Domain d5g03a_: 5g03 A:

Lineage for d5g03a_ (5g03 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (29 PDB entries)

8. Domain d5g03a_: 5g03 A: [317726]
   automated match to d4r5aa_
   complexed with oe2, so4, zn

Details for d5g03a_

PDB Entry: 5g03, 1.35 Å

PDB Description: an unusual natural product primary sulfonamide: synthesis, carbonic anhydrase inhibition and protein x-ray structure of psammaplin c

PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5g03a_:

Sequence; same for both SEQRES and ATOM records:

>d5g03a_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvdkalqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaegvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

Timeline for d5g03a_:

• d5g03a_ is new in SCOPe 2.06-stable
  
• d5g03a_ appears in SCOPe 2.07
  
• d5g03a_ appears in the current release, SCOPe 2.08