Lineage for d5f12a_ (5f12 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465114Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2465123Protein Trp repressor binding protein WrbA [117475] (4 species)
  7. 2465148Species Escherichia coli [TaxId:83333] [317703] (2 PDB entries)
  8. 2465151Domain d5f12a_: 5f12 A: [317713]
    automated match to d2rg1b_
    complexed with fmn

Details for d5f12a_

PDB Entry: 5f12 (more details), 1.5 Å

PDB Description: wrba in complex with fmn under crystallization conditions of wrba-fmn- bq structure (4yqe)
PDB Compounds: (A:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d5f12a_:

Sequence, based on SEQRES records: (download)

>d5f12a_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Sequence, based on observed residues (ATOM records): (download)

>d5f12a_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Escherichia coli [TaxId: 83333]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqgtpygattiaggdgsrqpsqeelsiary
qgeyvaglavklng

SCOPe Domain Coordinates for d5f12a_:

Click to download the PDB-style file with coordinates for d5f12a_.
(The format of our PDB-style files is described here.)

Timeline for d5f12a_: