Lineage for d1d9te_ (1d9t E:)
Root: SCOP 1.61 
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.35: Phosphosugar isomerase [52511] (1 superfamily) Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) 
Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein) Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [52516] (1 PDB entry) 
Domain d1d9te_: 1d9t E: [31771]
Details for d1d9te_
PDB Entry: 1d9t (more details), 1.75 Å
PDB Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a
SCOP Domain Sequences for d1d9te_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9te_ c.35.1.1 (E:) Glucosamine 6-phosphate deaminase/isomerase {Human (Homo sapiens)}
mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
edatlelkvktvkyfkglmlvhnklvdplysike
SCOP Domain Coordinates for d1d9te_:
Click to download the PDB-style file with coordinates for d1d9te_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d9te_:
- d1d9te_ first appeared (with stable ids) in SCOP 1.55
- d1d9te_ appears in SCOP 1.59
- d1d9te_ last appears in SCOP 1.63
View in 3D
