Lineage for d5bnib_ (5bni B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117411Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2117652Family c.23.14.0: automated matches [191355] (1 protein)
    not a true family
  6. 2117653Protein automated matches [190390] (3 species)
    not a true protein
  7. 2117661Species Sus scrofa [TaxId:9823] [317655] (2 PDB entries)
  8. 2117665Domain d5bnib_: 5bni B: [317706]
    automated match to d2ef1b_
    complexed with avw

Details for d5bnib_

PDB Entry: 5bni (more details), 2.5 Å

PDB Description: porcine cd38 complexed with complexed with a covalent intermediate, ribo-f-ribose-5'-phosphate
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5bnib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnib_ c.23.14.0 (B:) automated matches {Sus scrofa [TaxId: 9823]}
wngkgstvdfqeiilrrcytyirvvqpelgdrdcqkikkaftdafiskdpcsareedydl
lmklghqtvpcdktvfwsktkelahqytktqkglftlentllgyiaddlswcgkvgssei
nlescpdrrncnsnfvsvfwnllskrfaenacgmvqvflngsisnafdktstfgrvevhs
lqpskvhtlkawvihdsgktprdtcsgssinelqlilrgknikftcqenyr

SCOPe Domain Coordinates for d5bnib_:

Click to download the PDB-style file with coordinates for d5bnib_.
(The format of our PDB-style files is described here.)

Timeline for d5bnib_: