![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.0: automated matches [191355] (1 protein) not a true family |
![]() | Protein automated matches [190390] (3 species) not a true protein |
![]() | Species Sus scrofa [TaxId:9823] [317655] (2 PDB entries) |
![]() | Domain d5bnib_: 5bni B: [317706] automated match to d2ef1b_ complexed with avw |
PDB Entry: 5bni (more details), 2.5 Å
SCOPe Domain Sequences for d5bnib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnib_ c.23.14.0 (B:) automated matches {Sus scrofa [TaxId: 9823]} wngkgstvdfqeiilrrcytyirvvqpelgdrdcqkikkaftdafiskdpcsareedydl lmklghqtvpcdktvfwsktkelahqytktqkglftlentllgyiaddlswcgkvgssei nlescpdrrncnsnfvsvfwnllskrfaenacgmvqvflngsisnafdktstfgrvevhs lqpskvhtlkawvihdsgktprdtcsgssinelqlilrgknikftcqenyr
Timeline for d5bnib_: