Lineage for d1d9td_ (1d9t D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179007Fold c.35: Phosphosugar isomerase [52511] (1 superfamily)
  4. 179008Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) (S)
  5. 179009Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 179010Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 179028Species Human (Homo sapiens) [TaxId:9606] [52516] (1 PDB entry)
  8. 179032Domain d1d9td_: 1d9t D: [31770]

Details for d1d9td_

PDB Entry: 1d9t (more details), 1.75 Å

PDB Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a

SCOP Domain Sequences for d1d9td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9td_ c.35.1.1 (D:) Glucosamine 6-phosphate deaminase/isomerase {Human (Homo sapiens)}
mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
edatlelkvktvkyfkglmlvhnklvdplysike

SCOP Domain Coordinates for d1d9td_:

Click to download the PDB-style file with coordinates for d1d9td_.
(The format of our PDB-style files is described here.)

Timeline for d1d9td_: