SCOPe 2.06: Domain d5dtsb_: 5dts B:

Lineage for d5dtsb_ (5dts B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (23 PDB entries)

8. Domain d5dtsb_: 5dts B: [317699]
   automated match to d4s2kb_
   complexed with 5f8, cl

Details for d5dtsb_

PDB Entry: 5dts, 1.94 Å

PDB Description: fragments bound to the oxa-48 beta-lactamase: compound 2

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5dtsb_:

Sequence; same for both SEQRES and ATOM records:

>d5dtsb_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d5dtsb_:

• d5dtsb_ is new in SCOPe 2.06-stable
  
• d5dtsb_ appears in SCOPe 2.07
  
• d5dtsb_ appears in the current release, SCOPe 2.08