![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
![]() | Protein Enterochelin uptake protein CeuE [142792] (1 species) |
![]() | Species Campylobacter jejuni [TaxId:197] [142793] (11 PDB entries) Uniprot Q0P8Q4 44-330 |
![]() | Domain d5advb_: 5adv B: [317667] automated match to d3zkwa_ complexed with dbs, dms, ehs, fe |
PDB Entry: 5adv (more details), 2.1 Å
SCOPe Domain Sequences for d5advb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5advb_ c.92.2.4 (B:) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]} lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq srfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgil dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk
Timeline for d5advb_: