Lineage for d5bnfb_ (5bnf B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440985Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2441226Family c.23.14.0: automated matches [191355] (1 protein)
    not a true family
  6. 2441227Protein automated matches [190390] (3 species)
    not a true protein
  7. 2441235Species Pig (Sus scrofa) [TaxId:9823] [317655] (2 PDB entries)
  8. 2441237Domain d5bnfb_: 5bnf B: [317657]
    automated match to d2ef1b_

Details for d5bnfb_

PDB Entry: 5bnf (more details), 2.3 Å

PDB Description: apo structure of porcine cd38
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5bnfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnfb_ c.23.14.0 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
wngkgstvdfqeiilrrcytyirvvqpelgdrdcqkikkaftdafiskdpcsareedydl
lmklghqtvpcdktvfwsktkelahqytktqkglftlentllgyiaddlswcgkvgssei
nlescpdrrncnsnfvsvfwnllskrfaenacgmvqvflngsisnafdktstfgrvevhs
lqpskvhtlkawvihdsgktprdtcsgssinelqlilrgknikftcqenyrp

SCOPe Domain Coordinates for d5bnfb_:

Click to download the PDB-style file with coordinates for d5bnfb_.
(The format of our PDB-style files is described here.)

Timeline for d5bnfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5bnfa_