SCOPe 2.08: Domain d5bnfb_: 5bnf B:

Lineage for d5bnfb_ (5bnf B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.0: automated matches [191355] (1 protein)
   not a true family

6. Protein automated matches [190390] (4 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [317655] (2 PDB entries)

8. Domain d5bnfb_: 5bnf B: [317657]
   automated match to d2ef1b_

Details for d5bnfb_

PDB Entry: 5bnf, 2.3 Å

PDB Description: apo structure of porcine cd38

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5bnfb_:

Sequence; same for both SEQRES and ATOM records:

>d5bnfb_ c.23.14.0 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
wngkgstvdfqeiilrrcytyirvvqpelgdrdcqkikkaftdafiskdpcsareedydl
lmklghqtvpcdktvfwsktkelahqytktqkglftlentllgyiaddlswcgkvgssei
nlescpdrrncnsnfvsvfwnllskrfaenacgmvqvflngsisnafdktstfgrvevhs
lqpskvhtlkawvihdsgktprdtcsgssinelqlilrgknikftcqenyrp

Timeline for d5bnfb_:

• d5bnfb_ first appeared in SCOPe 2.06
  
• d5bnfb_ appears in SCOPe 2.07