Lineage for d5byvh1 (5byv H:4-278)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917796Species Mycobacterium smegmatis [TaxId:246196] [317395] (4 PDB entries)
  8. 2917811Domain d5byvh1: 5byv H:4-278 [317643]
    automated match to d4wysa1

Details for d5byvh1

PDB Entry: 5byv (more details), 2.16 Å

PDB Description: crystal structure of msm-13, a putative t1-like thiolase from mycobacterium smegmatis
PDB Compounds: (H:) Beta-ketothiolase

SCOPe Domain Sequences for d5byvh1:

Sequence, based on SEQRES records: (download)

>d5byvh1 c.95.1.0 (H:4-278) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
lavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpvllk
qdpeatvtagnssgqndaasmcivttpekaaelgl

Sequence, based on observed residues (ATOM records): (download)

>d5byvh1 c.95.1.0 (H:4-278) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
lavrshqravaaqsegvlaeeiipvpvretisvdehpradttvealaklkpvllkqdpea
tvtagnssgqndaasmcivttpekaaelgl

SCOPe Domain Coordinates for d5byvh1:

Click to download the PDB-style file with coordinates for d5byvh1.
(The format of our PDB-style files is described here.)

Timeline for d5byvh1: