Lineage for d1hota_ (1hot A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922307Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2922312Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 2922313Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 2922325Domain d1hota_: 1hot A: [31764]
    complexed with 16g, po4

Details for d1hota_

PDB Entry: 1hot (more details), 2.4 Å

PDB Description: glucosamine 6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucosamine-6-phosphate
PDB Compounds: (A:) glucosamine 6-phosphate deaminase

SCOPe Domain Sequences for d1hota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hota_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOPe Domain Coordinates for d1hota_:

Click to download the PDB-style file with coordinates for d1hota_.
(The format of our PDB-style files is described here.)

Timeline for d1hota_: