![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.1: NagB-like [52513] (3 proteins) share a common phosphate-binding site with the RpiA family |
![]() | Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [52515] (10 PDB entries) |
![]() | Domain d1hota_: 1hot A: [31764] complexed with 16g, po4 |
PDB Entry: 1hot (more details), 2.4 Å
SCOPe Domain Sequences for d1hota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hota_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]} mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd epstmelkvktlryfneleaenikgl
Timeline for d1hota_: