![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [317395] (4 PDB entries) |
![]() | Domain d5byvj2: 5byv J:279-404 [317634] automated match to d4wysa2 |
PDB Entry: 5byv (more details), 2.16 Å
SCOPe Domain Sequences for d5byvj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5byvj2 c.95.1.0 (J:279-404) automated matches {Mycobacterium smegmatis [TaxId: 246196]} kplvrlvswgsagvapdlmgigpvpatevalakagltladidlielneafaaqalavmre wkfgeadhertnvrgsgislghpvgatggrmlatlarelhrrearygletmcigggqgla avferv
Timeline for d5byvj2: