SCOPe 2.05: Domain d1horb_: 1hor B:

Lineage for d1horb_ (1hor B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.1: NagB-like [52513] (3 proteins)
   share a common phosphate-binding site with the RpiA family

6. Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)

7. Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)

8. Domain d1horb_: 1hor B: [31763]
   complexed with agp, po4

Details for d1horb_

PDB Entry: 1hor, 2.4 Å

PDB Description: structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution

PDB Compounds: (B:) glucosamine 6-phosphate deaminase

SCOPe Domain Sequences for d1horb_:

Sequence; same for both SEQRES and ATOM records:

>d1horb_ c.124.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

Timeline for d1horb_:

• d1horb_ first appeared (with stable ids) in SCOP 1.55
  
• d1horb_ appears in SCOPe 2.04
  
• d1horb_ appears in SCOPe 2.06
  
• d1horb_ appears in the current release, SCOPe 2.08