SCOPe 2.07: Domain d5byvm2: 5byv M:279-405

Lineage for d5byvm2 (5byv M:279-405)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.0: automated matches [196908] (1 protein)
not a true family
Protein automated matches [196909] (81 species)
not a true protein
Species Mycobacterium smegmatis [TaxId:246196] [317395] (4 PDB entries)
Domain d5byvm2: 5byv M:279-405 [317626]
automated match to d4wysa2

Details for d5byvm2

PDB Entry: 5byv (more details), 2.16 Å

PDB Description: crystal structure of msm-13, a putative t1-like thiolase from mycobacterium smegmatis

PDB Compounds: (M:) Beta-ketothiolase

SCOPe Domain Sequences for d5byvm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5byvm2 c.95.1.0 (M:279-405) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
kplvrlvswgsagvapdlmgigpvpatevalakagltladidlielneafaaqalavmre
wkfgeadhertnvrgsgislghpvgatggrmlatlarelhrrearygletmcigggqgla
avfervq

SCOPe Domain Coordinates for d5byvm2:

Click to download the PDB-style file with coordinates for d5byvm2.
(The format of our PDB-style files is described here.)

Timeline for d5byvm2: