Lineage for d5byvd2 (5byv D:279-404)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917796Species Mycobacterium smegmatis [TaxId:246196] [317395] (4 PDB entries)
  8. 2917804Domain d5byvd2: 5byv D:279-404 [317622]
    automated match to d4wysa2

Details for d5byvd2

PDB Entry: 5byv (more details), 2.16 Å

PDB Description: crystal structure of msm-13, a putative t1-like thiolase from mycobacterium smegmatis
PDB Compounds: (D:) Beta-ketothiolase

SCOPe Domain Sequences for d5byvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5byvd2 c.95.1.0 (D:279-404) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
kplvrlvswgsagvapdlmgigpvpatevalakagltladidlielneafaaqalavmre
wkfgeadhertnvrgsgislghpvgatggrmlatlarelhrrearygletmcigggqgla
avferv

SCOPe Domain Coordinates for d5byvd2:

Click to download the PDB-style file with coordinates for d5byvd2.
(The format of our PDB-style files is described here.)

Timeline for d5byvd2: