Lineage for d1deab_ (1dea B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922307Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2922312Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 2922313Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 2922315Domain d1deab_: 1dea B: [31761]
    complexed with po4

Details for d1deab_

PDB Entry: 1dea (more details), 2.1 Å

PDB Description: structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution
PDB Compounds: (B:) glucosamine 6-phosphate deaminase

SCOPe Domain Sequences for d1deab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deab_ c.124.1.1 (B:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOPe Domain Coordinates for d1deab_:

Click to download the PDB-style file with coordinates for d1deab_.
(The format of our PDB-style files is described here.)

Timeline for d1deab_: