| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) ![]() possibly related to the ubiquitin-like superfamily |
| Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins) |
| Protein automated matches [190522] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries) |
| Domain d5ikcm1: 5ikc M:52-139 [317602] Other proteins in same PDB: d5ikca1, d5ikca2, d5ikca3, d5ikcl1, d5ikcl2, d5ikcl3, d5ikcm2, d5ikcn2 automated match to d5io9b_ complexed with cl |
PDB Entry: 5ikc (more details), 2.06 Å
SCOPe Domain Sequences for d5ikcm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ikcm1 d.15.11.1 (M:52-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffkkveyt
Timeline for d5ikcm1: