SCOPe 2.07: Domain d5ikcm1: 5ikc M:52-139

Lineage for d5ikcm1 (5ikc M:52-139)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.11: Doublecortin (DC) [89837] (1 family)
   possibly related to the ubiquitin-like superfamily

5. Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)

6. Protein automated matches [190522] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)

8. Domain d5ikcm1: 5ikc M:52-139 [317602]
   Other proteins in same PDB: d5ikca1, d5ikca2, d5ikca3, d5ikcl1, d5ikcl2, d5ikcl3, d5ikcm2, d5ikcn2
   automated match to d5io9b_
   complexed with cl

Details for d5ikcm1

PDB Entry: 5ikc, 2.06 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin in complex with fab

PDB Compounds: (M:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5ikcm1:

Sequence; same for both SEQRES and ATOM records:

>d5ikcm1 d.15.11.1 (M:52-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffkkveyt

Timeline for d5ikcm1:

• d5ikcm1 first appeared in SCOPe 2.06
  
• d5ikcm1 appears in the current release, SCOPe 2.08