Lineage for d5ikcm1 (5ikc M:52-139)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2504283Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 2504284Family d.15.11.1: Doublecortin (DC) [89838] (3 protein domains)
  6. 2504293Protein automated matches [190522] (1 species)
    not a true protein
  7. 2504294Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)
  8. 2504297Domain d5ikcm1: 5ikc M:52-139 [317602]
    Other proteins in same PDB: d5ikca1, d5ikca2, d5ikca3, d5ikcl1, d5ikcl2, d5ikcl3, d5ikcm2, d5ikcn2
    automated match to d5io9b_
    complexed with cl

Details for d5ikcm1

PDB Entry: 5ikc (more details), 2.06 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin in complex with fab
PDB Compounds: (M:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5ikcm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ikcm1 d.15.11.1 (M:52-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffkkveyt

SCOPe Domain Coordinates for d5ikcm1:

Click to download the PDB-style file with coordinates for d5ikcm1.
(The format of our PDB-style files is described here.)

Timeline for d5ikcm1: