Lineage for d1deaa_ (1dea A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily) Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) 
Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein) Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species) 
Species Escherichia coli [TaxId:562] [52515] (4 PDB entries) 
Domain d1deaa_: 1dea A: [31760]
Details for d1deaa_
PDB Entry: 1dea (more details), 2.1 Å
PDB Description: structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution
SCOP Domain Sequences for d1deaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deaa_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl
SCOP Domain Coordinates for d1deaa_:
Click to download the PDB-style file with coordinates for d1deaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1deaa_:
- d1deaa_ appears in SCOP 1.57
- d1deaa_ appears in the current release, SCOPe 2.08
View in 3D
