Lineage for d1deaa_ (1dea A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22835Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily)
  4. 22836Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) (S)
  5. 22837Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 22838Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 22839Species Escherichia coli [TaxId:562] [52515] (4 PDB entries)
  8. 22840Domain d1deaa_: 1dea A: [31760]

Details for d1deaa_

PDB Entry: 1dea (more details), 2.1 Å

PDB Description: structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution

SCOP Domain Sequences for d1deaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deaa_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1deaa_:

Click to download the PDB-style file with coordinates for d1deaa_.
(The format of our PDB-style files is described here.)

Timeline for d1deaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1deab_