Lineage for d4zvvc2 (4zvv C:160-331)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines familySuperfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866Protein Lactate dehydrogenase [56339] (20 species) 
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (38 PDB entries) 
Domain d4zvvc2: 4zvv C:160-331 [317599]
Other proteins in same PDB: d4zvva1, d4zvvb1, d4zvvc1, d4zvvd1
automated match to d4jnka2
complexed with gn0, nad, so4
Details for d4zvvc2
PDB Entry: 4zvv (more details), 2.2 Å
PDB Description: lactate dehydrogenase a in complex with a trisubstituted piperidine-2, 4-dione inhibitor gne-140
PDB Compounds: (C:) L-lactate dehydrogenase A chainSCOPe Domain Sequences for d4zvvc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zvvc2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf
SCOPe Domain Coordinates for d4zvvc2:
Click to download the PDB-style file with coordinates for d4zvvc2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4zvvc2:
View in 3D
