Lineage for d1e20a_ (1e20 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22829Fold c.34: Halotolerance protein Hal3 [52506] (1 superfamily)
  4. 22830Superfamily c.34.1: Halotolerance protein Hal3 [52507] (1 family) (S)
  5. 22831Family c.34.1.1: Halotolerance protein Hal3 [52508] (1 protein)
  6. 22832Protein Halotolerance protein Hal3 [52509] (1 species)
  7. 22833Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52510] (1 PDB entry)
  8. 22834Domain d1e20a_: 1e20 A: [31759]

Details for d1e20a_

PDB Entry: 1e20 (more details), 2.02 Å

PDB Description: the fmn binding protein athal3

SCOP Domain Sequences for d1e20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e20a_ c.34.1.1 (A:) Halotolerance protein Hal3 {Mouse-ear cress (Arabidopsis thaliana)}
rkprvllaasgsvaaikfgnlchcftewaevravvtksslhfldklslpqevtlytdede
wsswnkigdpvlhielrrwadvlviaplsantlgkiagglcdnlltciirawdytkplfv
apamntlmwnnpfterhllsldelgitlippikkrlacgdygngamaepsliystvrlfw
esqah

SCOP Domain Coordinates for d1e20a_:

Click to download the PDB-style file with coordinates for d1e20a_.
(The format of our PDB-style files is described here.)

Timeline for d1e20a_: