Lineage for d1e20a_ (1e20 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.34: Halotolerance protein Hal3 [52506] (1 superfamily) Superfamily c.34.1: Halotolerance protein Hal3 [52507] (1 family) 
Family c.34.1.1: Halotolerance protein Hal3 [52508] (1 protein) Protein Halotolerance protein Hal3 [52509] (1 species) Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [52510] (1 PDB entry) 
Domain d1e20a_: 1e20 A: [31759]
Details for d1e20a_
PDB Entry: 1e20 (more details), 2.02 Å
PDB Description: the fmn binding protein athal3
SCOP Domain Sequences for d1e20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e20a_ c.34.1.1 (A:) Halotolerance protein Hal3 {Mouse-ear cress (Arabidopsis thaliana)}
rkprvllaasgsvaaikfgnlchcftewaevravvtksslhfldklslpqevtlytdede
wsswnkigdpvlhielrrwadvlviaplsantlgkiagglcdnlltciirawdytkplfv
apamntlmwnnpfterhllsldelgitlippikkrlacgdygngamaepsliystvrlfw
esqah
SCOP Domain Coordinates for d1e20a_:
Click to download the PDB-style file with coordinates for d1e20a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e20a_:
- d1e20a_ appears in SCOP 1.57
- d1e20a_ appears in the current release, SCOPe 2.08
View in 3D