Lineage for d1e20a_ (1e20 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864431Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864432Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2864433Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 proteins)
    Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family
  6. 2864434Protein 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) [52509] (2 species)
    involved in signal transduction; binds FMN
  7. 2864440Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52510] (3 PDB entries)
  8. 2864443Domain d1e20a_: 1e20 A: [31759]
    complexed with bme, fmn, ni

Details for d1e20a_

PDB Entry: 1e20 (more details), 2.02 Å

PDB Description: the fmn binding protein athal3
PDB Compounds: (A:) halotolerance protein hal3

SCOPe Domain Sequences for d1e20a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e20a_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkprvllaasgsvaaikfgnlchcftewaevravvtksslhfldklslpqevtlytdede
wsswnkigdpvlhielrrwadvlviaplsantlgkiagglcdnlltciirawdytkplfv
apamntlmwnnpfterhllsldelgitlippikkrlacgdygngamaepsliystvrlfw
esqah

SCOPe Domain Coordinates for d1e20a_:

Click to download the PDB-style file with coordinates for d1e20a_.
(The format of our PDB-style files is described here.)

Timeline for d1e20a_: