Lineage for d5h8za_ (5h8z A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402431Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2402432Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2402433Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 protein domains)
  6. 2402443Protein automated matches [190386] (3 species)
    not a true protein
  7. 2402448Species Chlorobium tepidum [TaxId:194439] [317468] (1 PDB entry)
  8. 2402449Domain d5h8za_: 5h8z A: [317586]
    automated match to d3bsda_
    complexed with bcl; mutant

Details for d5h8za_

PDB Entry: 5h8z (more details), 1.8 Å

PDB Description: crystal structure of the c49a c353a mutant fenna-matthews-olson protein from chlorobaculum tepidum
PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d5h8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h8za_ b.75.1.1 (A:) automated matches {Chlorobium tepidum [TaxId: 194439]}
vttahsdyeivleggssswgkvkarakvnappaspllpadadvklnvkpldpakgfvris
avfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsd
avrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigp
aftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkl
nrpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfn
vdaqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvakggvgqfeilyaq

SCOPe Domain Coordinates for d5h8za_:

Click to download the PDB-style file with coordinates for d5h8za_.
(The format of our PDB-style files is described here.)

Timeline for d5h8za_: