![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains) automatically mapped to Pfam PF00121 |
![]() | Protein automated matches [196175] (7 species) not a true protein |
![]() | Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries) |
![]() | Domain d5i3id_: 5i3i D: [317579] automated match to d1tpfa_ complexed with pga |
PDB Entry: 5i3i (more details), 2.2 Å
SCOPe Domain Sequences for d5i3id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i3id_ c.1.1.1 (D:) automated matches {Trypanosoma brucei [TaxId: 5702]} skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaagtgkvatpq qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe fvdiikatq
Timeline for d5i3id_: