Lineage for d5jqgf1 (5jqg F:1-76)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444095Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2444096Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2444379Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2444380Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2444381Species Chicken (Gallus gallus) [TaxId:9031] [311384] (73 PDB entries)
  8. 2444401Domain d5jqgf1: 5jqg F:1-76 [317568]
    Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgc2, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf2, d5jqgf3
    automated match to d3tiia1
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqgf1

PDB Entry: 5jqg (more details), 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5jqgf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jqgf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5jqgf1:

Click to download the PDB-style file with coordinates for d5jqgf1.
(The format of our PDB-style files is described here.)

Timeline for d5jqgf1: