Lineage for d5j8yd1 (5j8y D:1137-1205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715571Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2715572Protein automated matches [190031] (3 species)
    not a true protein
  7. 2715573Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries)
  8. 2715580Domain d5j8yd1: 5j8y D:1137-1205 [317565]
    Other proteins in same PDB: d5j8ya2, d5j8yb2, d5j8yc2, d5j8yd2
    automated match to d4pzna_

Details for d5j8yd1

PDB Entry: 5j8y (more details), 1.98 Å

PDB Description: crystal structure of the scm-sam and sfmbt-sam heterodimer
PDB Compounds: (D:) Polycomb protein Sfmbt

SCOPe Domain Sequences for d5j8yd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j8yd1 a.60.1.0 (D:1137-1205) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pdtwnvydvsqflrvndctahcdtfsrnkidgkrllqltkddimpllgmkvgpalkisdl
iaqlkckvn

SCOPe Domain Coordinates for d5j8yd1:

Click to download the PDB-style file with coordinates for d5j8yd1.
(The format of our PDB-style files is described here.)

Timeline for d5j8yd1: