Lineage for d5jqge_ (5jqg E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339704Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2339705Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2339706Protein Stathmin 4 [101496] (2 species)
  7. 2339707Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (97 PDB entries)
  8. 2339736Domain d5jqge_: 5jqg E: [317561]
    Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgc2, d5jqgd1, d5jqgd2, d5jqgf1, d5jqgf2, d5jqgf3
    automated match to d4i55e_
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqge_

PDB Entry: 5jqg (more details), 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5jqge_:

Sequence, based on SEQRES records: (download)

>d5jqge_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5jqge_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke

SCOPe Domain Coordinates for d5jqge_:

Click to download the PDB-style file with coordinates for d5jqge_.
(The format of our PDB-style files is described here.)

Timeline for d5jqge_: