SCOPe 2.08: Domain d2nbea1: 2nbe A:1-59

Lineage for d2nbea1 (2nbe A:1-59)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d2nbea1: 2nbe A:1-59 [317551]
   Other proteins in same PDB: d2nbea2
   automated match to d2k39a_
   mutant

Details for d2nbea1

PDB Entry: 2nbe

PDB Description: solution structure of v26a mutant of ubiquitin at ph 2.0

PDB Compounds: (A:) entity

SCOPe Domain Sequences for d2nbea1:

Sequence; same for both SEQRES and ATOM records:

>d2nbea1 d.15.1.1 (A:1-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienakakiqdkegippdqqrlifagkqledgrtlsdy

Timeline for d2nbea1:

• d2nbea1 first appeared in SCOPe 2.06
  
• d2nbea1 appears in SCOPe 2.07