Lineage for d1nbac_ (1nba C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580964Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 580965Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (1 family) (S)
  5. 580966Family c.33.1.3: Isochorismatase-like hydrolases [100948] (6 proteins)
  6. 580973Protein N-carbamoylsarcosine amidohydrolase [52501] (1 species)
  7. 580974Species Arthrobacter sp. [52502] (1 PDB entry)
  8. 580977Domain d1nbac_: 1nba C: [31755]

Details for d1nbac_

PDB Entry: 1nba (more details), 2 Å

PDB Description: crystal structure analysis, refinement and enzymatic reaction mechanism of n-carbamoylsarcosine amidohydrolase from arthrobacter sp. at 2.0 angstroms resolution

SCOP Domain Sequences for d1nbac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbac_ c.33.1.3 (C:) N-carbamoylsarcosine amidohydrolase {Arthrobacter sp.}
tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
dpqpeveapadpv

SCOP Domain Coordinates for d1nbac_:

Click to download the PDB-style file with coordinates for d1nbac_.
(The format of our PDB-style files is described here.)

Timeline for d1nbac_: