![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
![]() | Protein automated matches [190031] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (3 PDB entries) |
![]() | Domain d5j8ya1: 5j8y A:803-877 [317548] Other proteins in same PDB: d5j8ya2, d5j8yb2, d5j8yc2, d5j8yd2 automated match to d1pk3b_ |
PDB Entry: 5j8y (more details), 1.98 Å
SCOPe Domain Sequences for d5j8ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j8ya1 a.60.1.0 (A:803-877) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} pidwtieeviqyiesndnslavhgdlfrkheidgkallllnsemmmkymglkegpaekic nlvnkvngrrnnlal
Timeline for d5j8ya1: