Lineage for d5jqga2 (5jqg A:246-437)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525709Species Pig (Sus scrofa) [TaxId:9823] [278816] (24 PDB entries)
  8. 2525712Domain d5jqga2: 5jqg A:246-437 [317543]
    Other proteins in same PDB: d5jqga1, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3
    automated match to d4i50a2
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqga2

PDB Entry: 5jqg (more details), 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5jqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jqga2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5jqga2:

Click to download the PDB-style file with coordinates for d5jqga2.
(The format of our PDB-style files is described here.)

Timeline for d5jqga2: