SCOPe 2.08: Domain d5jqga1: 5jqg A:1-245

Lineage for d5jqga1 (5jqg A:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries)

8. Domain d5jqga1: 5jqg A:1-245 [317542]
   Other proteins in same PDB: d5jqga2, d5jqgb1, d5jqgb2, d5jqgc2, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2, d5jqgf3
   automated match to d4ihja1
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqga1

PDB Entry: 5jqg, 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5jqga1:

Sequence; same for both SEQRES and ATOM records:

>d5jqga1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5jqga1:

• d5jqga1 first appeared in SCOPe 2.06
  
• d5jqga1 appears in SCOPe 2.07