Lineage for d5ip4a1 (5ip4 A:8-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743786Domain d5ip4a1: 5ip4 A:8-112 [317537]
    Other proteins in same PDB: d5ip4a2, d5ip4b2
    automated match to d4bfbe_

Details for d5ip4a1

PDB Entry: 5ip4 (more details), 1.81 Å

PDB Description: x-ray structure of the c-terminal domain of human doublecortin
PDB Compounds: (A:) xa4551 nanobody against c-dcx

SCOPe Domain Sequences for d5ip4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ip4a1 b.1.1.1 (A:8-112) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlsctasvniiggnhwawyrqapgqqrdlvaslsrynanyadsvkgr
ftisrdnaknaaylqmnslkpedtaiyfcalenyywgqgtqvtvs

SCOPe Domain Coordinates for d5ip4a1:

Click to download the PDB-style file with coordinates for d5ip4a1.
(The format of our PDB-style files is described here.)

Timeline for d5ip4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ip4a2