Lineage for d5ikcl2 (5ikc L:111-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749236Domain d5ikcl2: 5ikc L:111-213 [317530]
    Other proteins in same PDB: d5ikca1, d5ikca3, d5ikcb1, d5ikcb2, d5ikch1, d5ikch2, d5ikcl1, d5ikcl3, d5ikcm1, d5ikcm2, d5ikcn1, d5ikcn2
    automated match to d2fbjl2
    complexed with cl

Details for d5ikcl2

PDB Entry: 5ikc (more details), 2.06 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin in complex with fab
PDB Compounds: (L:) MAb 6H10 light chain

SCOPe Domain Sequences for d5ikcl2:

Sequence, based on SEQRES records: (download)

>d5ikcl2 b.1.1.2 (L:111-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrne

Sequence, based on observed residues (ATOM records): (download)

>d5ikcl2 b.1.1.2 (L:111-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathstspivksfnrne

SCOPe Domain Coordinates for d5ikcl2:

Click to download the PDB-style file with coordinates for d5ikcl2.
(The format of our PDB-style files is described here.)

Timeline for d5ikcl2: