Lineage for d5ikcl1 (5ikc L:2-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760179Domain d5ikcl1: 5ikc L:2-110 [317529]
    Other proteins in same PDB: d5ikca2, d5ikca3, d5ikcb1, d5ikcb2, d5ikch1, d5ikch2, d5ikcl2, d5ikcl3, d5ikcm1, d5ikcm2, d5ikcn1, d5ikcn2
    automated match to d2fbjl1
    complexed with cl

Details for d5ikcl1

PDB Entry: 5ikc (more details), 2.06 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin in complex with fab
PDB Compounds: (L:) MAb 6H10 light chain

SCOPe Domain Sequences for d5ikcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ikcl1 b.1.1.0 (L:2-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivmtqsqklmstsvgdrvsitckasqivdtavawyqqkpgqspkpliylasnrhtgvpdr
ftgsgsgtdftltinnvqsddladyfclqhwnypltfgagtklelkgad

SCOPe Domain Coordinates for d5ikcl1:

Click to download the PDB-style file with coordinates for d5ikcl1.
(The format of our PDB-style files is described here.)

Timeline for d5ikcl1: