Lineage for d1tubb1 (1tub B:1-245)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121663Protein Tubulin beta-subunit [52496] (2 species)
  7. 2121686Species Pig (Sus scrofa) [TaxId:9823] [52497] (3 PDB entries)
  8. 2121687Domain d1tubb1: 1tub B:1-245 [31752]
    Other proteins in same PDB: d1tuba1, d1tuba2, d1tubb2
    complexed with gdp, gtp, txl

Details for d1tubb1

PDB Entry: 1tub (more details), 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction
PDB Compounds: (B:) tubulin

SCOPe Domain Sequences for d1tubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d1tubb1:

Click to download the PDB-style file with coordinates for d1tubb1.
(The format of our PDB-style files is described here.)

Timeline for d1tubb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tubb2