![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) ![]() |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
![]() | Protein Tubulin beta-subunit [52496] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [52497] (1 PDB entry) |
![]() | Domain d1tubb1: 1tub B:1-245 [31752] Other proteins in same PDB: d1tuba1, d1tuba2, d1tubb2 complexed with gdp, gtp, txl |
PDB Entry: 1tub (more details), 3.7 Å
SCOPe Domain Sequences for d1tubb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d1tubb1: