SCOPe 2.06: Domain d5i3ha_: 5i3h A:

Lineage for d5i3ha_ (5i3h A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein automated matches [196175] (7 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries)

8. Domain d5i3ha_: 5i3h A: [317516]
   automated match to d1tpfa_
   complexed with k, pga

Details for d5i3ha_

PDB Entry: 5i3h, 2.25 Å

PDB Description: structure-function studies on role of hydrophobic clamping of a basic glutamate in catalysis by triosephosphate isomerase

PDB Compounds: (A:) Triosephosphate isomerase, glycosomal

SCOPe Domain Sequences for d5i3ha_:

Sequence; same for both SEQRES and ATOM records:

>d5i3ha_ c.1.1.1 (A:) automated matches {Trypanosoma brucei [TaxId: 5702]}
skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaagtgkvatpq
qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngfavggaslkpe
fvdiikatq

Timeline for d5i3ha_:

• d5i3ha_ is new in SCOPe 2.06-stable
  
• d5i3ha_ appears in SCOPe 2.07
  
• d5i3ha_ appears in the current release, SCOPe 2.08