Lineage for d5hx5a_ (5hx5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918718Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2918730Protein APOBEC3F [310758] (1 species)
  7. 2918731Species Human (Homo sapiens) [TaxId:9606] [311013] (5 PDB entries)
  8. 2918734Domain d5hx5a_: 5hx5 A: [317506]
    automated match to d2kema_
    complexed with zn

Details for d5hx5a_

PDB Entry: 5hx5 (more details), 2.33 Å

PDB Description: apobec3f catalytic domain crystal structure
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3F

SCOPe Domain Sequences for d5hx5a_:

Sequence, based on SEQRES records: (download)

>d5hx5a_ c.97.1.6 (A:) APOBEC3F {Human (Homo sapiens) [TaxId: 9606]}
npmeamdphifyfhfknlrkaygrneswlcftmevvkhhspvswkrgvfrnqvdpetgrh
aercflswfaddilspntnyevtwytswspcpecagevaeflarhsnvnltiktarlyyf
ddtdyqeglrslsqegasveimgykdfkycwenfvynddepfkpwdgldynfldldsklq
eile

Sequence, based on observed residues (ATOM records): (download)

>d5hx5a_ c.97.1.6 (A:) APOBEC3F {Human (Homo sapiens) [TaxId: 9606]}
npmeamdphifyfhfknlrkaygrneswlcftmevvkhvswkrgvfrnrhaercflswfa
ddilspntnyevtwytswspcpecagevaeflarhsnvnltiktarlyyfddtdyqeglr
slsqegasveimgykdfkycwenfvynddepfkpwdgldynfldldsklqeile

SCOPe Domain Coordinates for d5hx5a_:

Click to download the PDB-style file with coordinates for d5hx5a_.
(The format of our PDB-style files is described here.)

Timeline for d5hx5a_: